Here’s what Steven and I talked about and what I’ll focus on after I send out my RNA.
Here’s the post from yesterday where I laid out the agenda items: Here
TLDR: What I’ll Aim To Have by Next Week:
- A list of the
headof all the files I have from collaborators related to each species in the readme of the repository - Count matrices that I trust from each species
BLASToutputs from theaugustus.codingseq.aaor equivalent files from each species
i.jointheBLASTouptut with the count matrices
Also: Apply to funding from the College of the Environment for Conference Travel: DUE JULY 11
Notes on what we talked about:
For Each Species:
- Align data to respective genomes
- Get count matrices
- Annotate
BLAST to uniprot → https://github.com/grace-ac/paper-pycno-sswd-2021-2022/wiki/Key-Files
augustus.hints.aa
g3450.t1
MNYRTDDEIYEDEVDEETKLHHRIDERGVNGTDSRDEPTRVPPAKQLKIQAPVLASRLQLEAVRRPHPPPLHPPQIHLYLEPHLEALQQRCDSYKGIVG*
- Join with count matrix → this will functionally annotate it
- Make sure each count matrix has fasta file that has same gene name that can be joined